EGR1 (NM_001964) Human Recombinant Protein from OriGene Technologies

Product Details
ItemEGR1 (NM_001964) Human Recombinant Protein
CompanyOriGene Technologies
PriceSupplier Page
Catalog NumberTP720992
Quantity10 µg
Molecule NameEGR1

Add to Compare List

See More Life Science Supplies

OriGene Technologies

9620 Medical Center Drive

# 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only)
Phone: 301-340-3188
Fax: 301-340-9254

Company Profile

Website: www.origene.com/

(1) DNA-PKcs kinase activity stabilizes the transcription factor Egr1 in activated immune cellsThe Journal of biological chemistryOctober 1, 2021Waldrip ZJ, Burdine L, Harrison DK, Azevedo-Pouly AC, Storey AJ, Moffett OG, Mackintosh SG, Burdine MS.V6930) from Promega were used to perform this assay. The Egr1 substrate was ordered from Origene (Cat # TP720992). The amino acid sequence of this peptide is: SSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS. The

Be the First to Write a Review!

EGR1 (NM_001964) Human Recombinant Protein from OriGene Technologies

Description

Company Info

OriGene Technologies

Citations (1)

Be the First to Write a Review!