| Description | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1] | Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide acetate inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide acetate can inhibit oxidative stress, Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide acetate inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide acetate can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide acetate can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis, diabetes, Alzheimer's disease and atherosclerosis[1][2][3][4][5][6]... Read More | Parathyroid hormone (1-34) (rat) (acetate) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis[1][2] | Pyruvate Oxidase, Microorganisms (PoxB) is a thiamine pyrophosphate-dependent oxidase that catalyzes the oxidative decarboxylation of pyruvate to acetyl phosphate, carbon dioxide and water. Pyruvate oxidase is an important enzyme in bacterial metabolism and is often used in biochemical research[1] | Trifluoroacetyl tripeptide-2 is a tripeptide with strong cosmetic activity. Trifluoroacetyl tripeptide-2 can regulate progerin synthesis, promote extracellular matrix synthesis, and improve skin elasticity. Trifluoroacetyl tripeptide-2 has anti-wrinkle and firming effects and can be used as an anti-Trifluoroacetyl tripeptide-2 is a tripeptide with strong cosmetic activity. Trifluoroacetyl tripeptide-2 can regulate progerin synthesis, promote extracellular matrix synthesis, and improve skin elasticity. Trifluoroacetyl tripeptide-2 has anti-wrinkle and firming effects and can be used as an anti-aging ingredient in cosmetic research[1][2]... Read More |