| Description | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1] | Endomorphin 1, a high affinity, highly selective agonist of the µ-opioid receptor (Ki: 1.11 nM), displays reasonable affinities for kappa3 binding sites, with Ki value between 20 and 30 nM. Endomorphin 1 has antinociceptive properties[1][2][4] | KALA is an amphiphilic peptide that forms an α-helical structure at physiological pH. KALA modifies a plasmid DNA-encapsulating liposomal membrane and is used as a fusogenic peptide in order to achieve effective liver targeting and transfection of DNA via galactose receptors[1] | Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of pro-inflammatory cytokines, and suppresses of the Akt-MEK1/2 signaling pathway. Lixisenatide can inhibit oxidative stress, mitochondrial dysfunction and apoptosis. Lixisenatide can be used for the researches of inflammation, metabolic disease, neurological disease and cardiovascular disease, such as rheumatoid arthritis, diabetes, Alzheimer's disease and atherosclerosis[1][2][3][4][5][6]... Read More | STh, an Escherichia coli heat-stable toxin, is a 19 amino acid polypeptide encompassing three disulfide bridges. STh is an antigen of interest in the search for a broad coverage enterotoxigenic Escherichia coli (ETEC) vaccine[1] |