| Description | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1] | MCE 2× PCR Master Mix (with Dye) is provided as a simple-to-use, stabilized 2× formulation that includes all components for PCR except sample DNA, primers and water, in which bromophenol blue dye is included. The 1 mL is defined as the base specification. All larger sizes correspond to MCE 2× PCR Master Mix (with Dye) is provided as a simple-to-use, stabilized 2× formulation that includes all components for PCR except sample DNA, primers and water, in which bromophenol blue dye is included. The 1 mL is defined as the base specification. All larger sizes correspond to incremental volumes of this base... Read More | Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosisBulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research[1][2]... Read More | Cortistatin-14 is a neuropeptide that shares structural similarities with somatostatin, working by binding to somatostatin receptors (sst1-sst5). Cortistatin-14 (TFA) has anticonvulsant, neuroprotective effects, and significant anti-inflammatory properties[1][2][3] | Endomorphin 1 acetate, a high affinity, highly selective agonist of the µ-opioid receptor (Ki: 1.11 nM), displays reasonable affinities for kappa3 binding sites, with Ki value between 20 and 30 nM. Endomorphin 1 acetate has antinociceptive properties[1][2][4] |