| Description | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative | α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 µM[1][2] | ATI-2341 is a potent and functionally selective allosteric agonist of C-X-C chemokine receptor type 4 (CXCR4), which functions as a biased ligand, favoring Gαi activation over Gα13. ATI-2341 activates the inhibitory heterotrimeric G protein (Gi) to promote inhibition of cAMP production andATI-2341 is a potent and functionally selective allosteric agonist of C-X-C chemokine receptor type 4 (CXCR4), which functions as a biased ligand, favoring Gαi activation over Gα13. ATI-2341 activates the inhibitory heterotrimeric G protein (Gi) to promote inhibition of cAMP production and induce calcium mobilization. ATI-2341 is a potent and efficacious mobilizer of bone marrow polymorphonuclear neutrophils (PMNs) and hematopoietic stem and progenitor cells (HSPCs)[1][2]... Read More | Cyclo(His-Phe) TFA is aCyclic dipeptide | Laccase, Microorganisms (Denilite IIS) is a multi-copper oxidase (MCOs), which widely exists in microorganisms, plants and fungi, and can catalyze the oxidation of one electron of various phenolic compounds. Laccase can promote the oxidative coupling of single lignin, which plays an important role Laccase, Microorganisms (Denilite IIS) is a multi-copper oxidase (MCOs), which widely exists in microorganisms, plants and fungi, and can catalyze the oxidation of one electron of various phenolic compounds. Laccase can promote the oxidative coupling of single lignin, which plays an important role in the formation and biodegradation of lignin, and also has the potential to cross-link food polymers[1]... Read More |