| Description | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative | β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1] | Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity | Conalbumin (Ovotransferrin), also known as ovotransferrin, is a monomeric glycoprotein consisting of 686 amino acids, encoded by the avian transferrin gene in the oviduct, and a prominent component of chicken egg white. Exhibiting a unique glycosylation pattern that differentiates it from serum Conalbumin (Ovotransferrin), also known as ovotransferrin, is a monomeric glycoprotein consisting of 686 amino acids, encoded by the avian transferrin gene in the oviduct, and a prominent component of chicken egg white. Exhibiting a unique glycosylation pattern that differentiates it from serum transferrin, Conalbumin is a potent iron binder that plays a crucial role in iron transport to developing embryos. Additionally, it possesses a range of biological activities, including antimicrobial, antifungal, antiviral, anticancer, antioxidative, antihypertensive, and immunoregulatory properties, making it valuable in numerous applications such as infant formula ingredients, food additives, and agents for enhancing animal health... Read More | Glucose oxidase is used in the food and beverage industry as a preservative and stabilizer and is commonly derived from the fungus Aspergillus niger. Glucose oxidase can react with intracellular glucose and oxygen (O2) to produce hydrogen peroxide (H2O2) and gluconic acid, which can cut off the Glucose oxidase is used in the food and beverage industry as a preservative and stabilizer and is commonly derived from the fungus Aspergillus niger. Glucose oxidase can react with intracellular glucose and oxygen (O2) to produce hydrogen peroxide (H2O2) and gluconic acid, which can cut off the nutrition source of cancer cells and consequently inhibit their proliferation[1][2][3]... Read More |