| Quantity | 5 mg, 10 mg | 500 µ, g, 1 mg, 5 mg | 10 µ, g, 50 µ, g, 100 µ, g | 5 mg, 10 mg, 25 mg, 50 mg, 100 mg | 50 µ, L, 500 µ, L |
| Description | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative | Colivelin is a brain penetrant neuroprotective peptide and a potent activator of STAT3, suppresses neuronal death by activating STAT3 in vitro[1]. Colivelin exhibits long-term beneficial effects against neurotoxicity, Aβ deposition, neuronal apoptosis, and synaptic plasticity deficits in Colivelin is a brain penetrant neuroprotective peptide and a potent activator of STAT3, suppresses neuronal death by activating STAT3 in vitro[1]. Colivelin exhibits long-term beneficial effects against neurotoxicity, Aβ deposition, neuronal apoptosis, and synaptic plasticity deficits in neurodegenerative disease[2]. Colivelin has the potential for the treatment of alzheimer's disease and ischemic brain injury[1]... Read More | Luteinizing hormone (human), a heterodimeric glycoprotein hormone produced by the pituitary gland (LH), plays key roles in human reproduction[1] | Semax acetate is a nootropic neuroprotective peptide. Semax acetate can be used in the research of brain stroke[1] | Vari Fluor 647-Streptavidin is a dye marker of Vari Fluor-streptavidin consisting of labeling streptavidin with a Vari Fluor series of fluorescent probes. Streptavidin is a high-affinity tetramer protein, each tetramer consisting of four identical streptavidin subunits. Streptavidin binds to biotin Vari Fluor 647-Streptavidin is a dye marker of Vari Fluor-streptavidin consisting of labeling streptavidin with a Vari Fluor series of fluorescent probes. Streptavidin is a high-affinity tetramer protein, each tetramer consisting of four identical streptavidin subunits. Streptavidin binds to biotin specifically via a reversible non-covalent effect. Streptavidin can achieve rapid and efficient detection of biotin markers, and is often used in immunofluorescence (IF), enzyme-linked immunosorbent assay (ELISA), immunohistochemical staining (IFH), in situ hybridization (ISH) and other experiments. Ex/Em=650 nm/665 nm... Read More |